PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016476238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 429aa    MW: 49753 Da    PI: 9.4008
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016476238.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.83.4e-121896998
                    HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  9 dvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                      +k++ l +p  f+ ++  g++   +++  +  + +++W+vk+  ++++    ++ GW +F+++++L+ gD ++F+++g++ f   v +f+
  XP_016476238.1 18 PGFKHA-LKIPTGFL-KYlkGYD---HIEHAILRRGSKQWRVKV--NGCR----FEVGWADFAQQHDLQLGDLLIFRHEGNMVF--EVIIFD 96
                    455555.9*******.6655444...5677888999********..7777....999*********************999999..777776 PP

2B351.51.9e-16140222488
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.S CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.s 88 
                      +++s++l++g +++p +fa+++g++ ++  +l+++de+ rsW++kl    + +++++++ W +F  an+Lk+gD + F+++ + +
  XP_016476238.1 140 CTVRSYYLTNGYMRVPSRFASKNGLIYKK-CDLIIRDERQRSWNLKL--YTSCDHVYIGGRWAKFHAANDLKVGDRIKFEVVTNgE 222
                     5678*******************998655.59***************..99999**************************876523 PP

3B343.27.2e-14328414595
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     +++++ l+ + l+lp +fa ++g+++ ++ +l+++de+ rsW++ l  r  + ++ +++GW++  + + LkegD ++F+++  +++++v k
  XP_016476238.1 328 TIRPYCLTYSYLILPTQFALTNGLIN-KKYDLIIRDEWQRSWNLML--RPFGTSVCIRGGWSKLRDTHCLKEGDQIMFEVVT-DGTKPVWK 414
                     56788999999***********9995.668****************..*******************************876.56656655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.6E-185100IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.63E-197100IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.152998IPR003340B3 DNA binding domain
CDDcd100173.75E-131096No hitNo description
SMARTSM010194.0E-111298IPR003340B3 DNA binding domain
PfamPF023628.6E-92096IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.5E-16135228IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-17136231IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.406137231IPR003340B3 DNA binding domain
SMARTSM010191.7E-8138232IPR003340B3 DNA binding domain
PfamPF023621.1E-14141223IPR003340B3 DNA binding domain
CDDcd100171.46E-13143232No hitNo description
Gene3DG3DSA:2.40.330.102.5E-14321415IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-16323416IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.743324418IPR003340B3 DNA binding domain
SMARTSM010198.9E-12325419IPR003340B3 DNA binding domain
PfamPF023627.9E-12328414IPR003340B3 DNA binding domain
CDDcd100176.86E-11339412No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MKEKVRPAKP HFFKPIQPGF KHALKIPTGF LKYLKGYDHI EHAILRRGSK QWRVKVNGCR  60
FEVGWADFAQ QHDLQLGDLL IFRHEGNMVF EVIIFDSSHC DREYAEYLLQ EEDIVEEACK  120
KFKFKEAATH NPFGQSHFEC TVRSYYLTNG YMRVPSRFAS KNGLIYKKCD LIIRDERQRS  180
WNLKLYTSCD HVYIGGRWAK FHAANDLKVG DRIKFEVVTN GERPIWKFHV KRNPSIKSSS  240
KAFPYAEAAT HKPFGPSHLD SGHCNREYAE YLQEKEEEKE EAAGDAVEGT SKKFKLKEEP  300
NPSVKSSSKA FPHVEAAIHK PFGHFVCTIR PYCLTYSYLI LPTQFALTNG LINKKYDLII  360
RDEWQRSWNL MLRPFGTSVC IRGGWSKLRD THCLKEGDQI MFEVVTDGTK PVWKFHGKIS  420
GECKNQSRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770483.10.0PREDICTED: B3 domain-containing protein REM5-like isoform X3
RefseqXP_016476238.10.0PREDICTED: B3 domain-containing protein REM5-like isoform X1
TrEMBLK4CIB31e-136K4CIB3_SOLLC; Uncharacterized protein
STRINGSolyc08g006240.1.11e-136(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.14e-37B3 family protein